Protein C, Human

Manufacturer Assaypro
Category
Type Proteins
Specific against Human
Amount 0.1mg
Host Human
Item no. PP51021
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-Page
Presentation
20 mM Tris-HCl/ 0.1 M NaCl/ 1mM
Benzamidine/ pH 7.4
Sequence
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQ VLRIRKRANSFLEELRHSSLERECI EEICDFEEA KEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASL CCGHGTCIDGIGSFSC DCRSGWEGRFCQREVSFL NCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLL QCHPAVK FPCGRPWKRMEKKRSHLKRDTEDQEDQ VDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA V LIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKW ELDLDIKEVFVHPNYSKSTTDNDI ALLHLAQPAT LSQTIVPICLPDSGLAERELNQAGQETLVTGWGYH SSREKEAKRNRTFVL NFIKIPVVPHNECSEVMSN MVSENMLCAGILGDRQDACEGDSGGPMVASFHGTW FLVGLV SWGEGCGLLHNYGVYTKVSRYLDWIHGH IRDKEAPQKSWAP
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
5624
Omim
612283
Swiss Prot
P04070
Unigene
Hs.224698
Molecular Weight
52 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close