Prothrombin, Mouse

Manufacturer Assaypro
Category
Type Proteins
Specific against Mouse
Amount 100ug
Host Mouse
Item no. PP52105
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophlized
Sequence
MSHVRGLGLPGCLALAALVSLVHSQHVFLAPQQAL SLLQRVRRANSGFLEELRKGNLERE CVEEQCSYE EAFEALESPQDTDVFWAKYTVCDSVRKPRETFMDC LEGRCAMDLGVNYLGT VNVTHTGIQCQLWRSRYP HKPEINSTTHPGADLKENFCRNPDSSTTGPWCYTT DPTVRRE ECSVPVCGQEGRTTVVMTPRSGGSKDN LSPPLGQCLTERGRLYQGNLAVTTLGSPCLPWN S LPAKTLSKYQDFDPEVKLVENFCRNPDWDEEGAWC YVAGQPGDFEYCNLNYCEEAVGEE NYDVDESIAG RTTDAEFHTFFNEKTFGLGEADCGLRPLFEKKSLK DTTEKELLDSYIDGR IVEGWDAEKGIAPWQVMLF RKSPQELLCGASLISDRWVLTAAHCILYPPWDKNF TENDLL VRIGKHSRTRYERNVEKISMLEKIYVHP RYNWRENLDRDIALLKLKKPVPFSDYIHPVCL PD KQTVTSLLRAGYKGRVTGWGNLRETWTTNINEIQP SVLQVVNLPIVERPVCKASTRIR ITDNMFCAGFK VNDTKRGDACEGDSGGPFVMKSPFNNRWYQMGIVS WGEGCDRKGKYGFY THVFRLKRWIQKVIDQFG
Storage
-60C or below
Associated Disease
Alzheimer's Disease, Blood Disorder, Sepsis, Chronic Gastrointestinal Disorder
Entrez Gene
14061
Omim
176930
Swiss Prot
P19221
Unigene
Mm.89048
Molecular Weight
70 kDa
Amount: 100ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close