Antithrombin , Rat

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Rat
Amount 0.1mg
Host Rat
ArtNr PA60100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
20 mM Tris-HCl/ 0.1 M sodium
Sequence
MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGS PVDICTAKPRDIPMN PMCIYRSPEKKATEDEGSE QKIPEATNRRVWELSKANSRFATTFYQHLAD SKN DNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVF KFDTISEKTSDQ IHFFFAKLNCRLYRKANKSSKL VSANRLFGDKSLTFNETYQDISELVYGA KLQPLD FKENAEQSRAAINKWVSNKTEGRITDVIPSEAINE LTVLVLVNT IYFKGLWKSKFSPENTRKELFYKAD GESCSASMMYQEGKFRYRRVAEGTQ VLELPFKGD DITMVLILPKPEKSLAKVEKELTPEVLQEWLDELE EMMLVV HMPRFRIEDGFSLKEQLQDMGLVDLFSP EKSKLPGIVAEGRDDLYVSDAF HKAFLEVNEEGS EAAASTAVVIAGRSLNPNRVTFKANRPFLVFIREV PLN TIIFMGRVANPCVK
Storage
-60C or below
Associated Disease
Cardiovascular
Entrez Gene
-
Omim
-
Molecular Weight
58 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close