Plasminogen, Rat

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Rat
Amount 1mg
Host Rat
ArtNr PP12051
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophlized
Sequence
DSLDGYVSTQGASLHSLTKKQLAAGSIADCLAKCE GETDFICRSFQYHSKEQQCVIMAENSKTSSIIRMR DVILFEKRVYLSECKTGIGKGYRGTMSKTKTGVTC QKWSDTSPHVPKYSPSTHPSEGLEENYCRNPDNDE QGPWCYTTDPDQRYEYCNIPECEEECMYCSGEKYE GKISKTMSGLDCQSWDSQSPHAHGYIPAKFPSKNL KMNYCRNPDGEPRPWCFTTDPNKRWEYCDIPRCTT PPPPPGPTYQCLKGRGENYRGTVSVTASGKTCQRW SEQTPHRHNRTPENFPCKNLEENYCRNPDGETAPW CYTTDSQLRWEYCEIPSCGSSVSPDQSDSSVLPEQ TPVVQECYQGNGKSYRGTSSTTNTGKKCQSWVSMT PHSHSKTPANFPDAGLEMNYCRNPDNDQRGPWCFT TDPSVRWEYCNLKRCSETGGGVAESAIVPQVPSAP GTSETDCMYGNGKEYRGKTAVTAAGTPCQEWAAQE PHSHRIFTPQTNPRAGLEKNYCRNPDGDVNGPWCY TMNPRKLYDYCNIPLCASLSSFECGKPQVEPKKCP GRVVGGCVANPHSWPWQISLRTRFSGQHFCGGTLI SPEWVLTAAHCLEKSSRPEFYKVILGAHEERILGS DVQQIAVTKLVLEPNDADIALLKLSRPATITDNVI PACLPSPNYVVADRTLCYITGWGETKGTPGAGRLK EAQLPVIENKVCNRAEYLNNRVKSTELCAGHLAGG IDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARP NKPGVYVRVSRYVNWIEREMRND
Storage
-60C or below
Associated Disease
Glomerulonephritis, Cardiovascular
Entrez Gene
85253
Omim
173350
Swiss Prot
Q01177
Unigene
Rn.20178
Molecular Weight
90 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close