« Back
Home /
E2F7 Antibody - N-terminal region

E2F7 Antibody - N-terminal region

Item no.	ARP37584_T100
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	LFRPIENKEDAFVNSLQLDVAGDGAVDEYEKQRPSRKQKSLGLLCQKFLA
Citations	de Bruin,A., et al., (2003) J. Biol. Chem. 278 (43), 42041-42049
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	E2F-7,D10Ertd739,D10Ertd739e,A630014C11Rik
Similar products	E2F7
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	100 kDa
Species Tested	Mouse
Gene symbol	E2F7
Gene Fullname	E2F transcription factor 7
Protein size	904
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	E2F7 is a E2F family member. It can block the E2F-dependent activation of a subset of E2F target genes as well as mitigate cellular proliferation of mouse embryo fibroblasts
Nucleotide accession_num	NM_178609
Protein accession_num	NP_848724
Protein name	Transcription factor E2F7
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of mouse E2F7
Homology	Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 93%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 11/13/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer