Comparison

MSX1 Antibody - N-terminal region

Item no. ARP37094_T100
Manufacturer AVIVA Systems Biology
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Dog (Canine, Canis lupus familiaris), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host Rabbit
Sequence KPGAKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVG
Citations Necdin, a Prader-Willi syndrome candidate gene, regulates gonadotropin-releasing hormone neurons during development. Hum Mol Genet. 18, 248-60 (2009). 18930956
Lee,H., et al., (2006) Genes Dev. 20 (7), 784-794
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias ms,Hox,msh,Hox-,Hox7,Hox-7,Hox7.,Hox7.1,AA675338,AI324650
Similar products MSX1
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Products/Polyclonal Antibodies/Growth Factors & Hormones, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Morphogenesis, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
33kDa
Species Tested
Mouse
Gene symbol
MSX1
Gene Fullname
Homeobox, msh-like 1
Protein size
299
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
Mc5r; Mc4r; Mc3r; Mc1r; Hist1h1a; Hist1h1b; Hist1h1e; Tle4; Pou2f1; Msx1; Aes; Tbp; Dlx2; Gmnn; Pax9; Myod1;
Description of target
MSX1 belongs to the MSX family. MSX and DLX are members of the Antennapedia class of non-Hox homeodomain transcription factors that regulate gene expression and influence development of the craniofacial structures and anterior forebrain.
Nucleotide accession_num
NM_010835
Protein accession_num
NP_034965
Protein name
Homeobox protein MSX-1
Clonality
Polyclonal
Purification
Protein A purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse MSX1
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Concentration
1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close