« Back
Home /
CBX1 Antibody - N-terminal region

CBX1 Antibody - N-terminal region

Item no.	ARP34426_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Neuroscience Neural Lineage Markers Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Epigenetics Neural Development Antibodies Western Blot Primary Antibodies By Organ Bladder Cancer Adhesion Molecule Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Zebrafish (Danio rerio), Yeast (Saccharomyces cerevisiae), Cow (Bos taurus)
Host	Rabbit
Sequence	MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDN
Citations	Ayoub,N., (er) Nature (2008) In press
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CBX,M31,MOD1,p25beta,HP1-BETA,HP1Hsbeta,HP1Hs-beta
Similar products	CBX1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Epigenetics, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	21kDa
Species Tested	Human
Gene symbol	CBX1
Gene Fullname	Chromobox homolog 1
Protein size	185
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	PRDM6; SUMO1; UBC; RNF2; PARK2; NR2F6; VHL; EHMT2; ABI3BP; VTN; TRIM39; CBX5; HIST1H3B; KLF11; HIST3H3; PCNA; MECP2; ADNP; POGZ; ADNP2; CBX3; TRIM28; CHAF1A; HIST1H4F; XRCC6; CHD4; H2AFB1; NSL1; SUMO2; HIST1H3A; Mad2l2; Cbx1; DNMT3B; ZNF382; H3F3A; SUV420
Description of target	CBX1 is the component of heterochromatin. CBX1 recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. CBX1 interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the in
Nucleotide accession_num	NM_006807
Protein accession_num	NP_006798
Protein name	Chromobox protein homolog 1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human CBX1
Homology	Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93%
Concentration	0.5 mg/ml
Sample Type Confirmation	CBX1 is supported by BioGPS gene expression data to be expressed in OVCAR3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer