« Back
Home /
SLC1A1 Antibody - N-terminal region

SLC1A1 Antibody - N-terminal region

Item no.	ARP43865_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Food Safety Allergenes Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Antibodies By Cell Type Carcinoma Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Rabbit (Oryctolagus cuniculus)
Host	Rabbit
Sequence	VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN
Citations	Ruggiero,A.M., (2008) J. Biol. Chem. 283 (10), 6175-6183
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DCBXA,EAAC1,EAAT3,SCZD18
Similar products	SLC1A1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	57kDa
Species Tested	Human
Gene symbol	SLC1A1
Gene Fullname	Solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter, system Xag), member 1
Protein size	524
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	LDLRAD1; RNF5; APP; ARL6IP5; PRKCA; EWSR1;
Description of target	SLC1A1 transports L-glutamate and also L- and D-aspartate. It is essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. SLC1A1 acts as a symport by cotransporting sodium. It negatively regulated by ARL6IP5.
Nucleotide accession_num	NM_004170
Protein accession_num	NP_004161
Protein name	Excitatory amino acid transporter 3
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human SLC1A1
Homology	Human: 100%; Rabbit: 86%;
Concentration	0.5 mg/ml
Sample Type Confirmation	SLC1A1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer