« Back
Home /
CSNK1G2 Antibody - middle region

CSNK1G2 Antibody - middle region

Item no.	ARP51942_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Food Safety Allergenes Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CK1g2
Similar products	CSNK1G2
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	47kDa
Species Tested	Human
Gene symbol	CSNK1G2
Gene Fullname	Casein kinase 1, gamma 2
Protein size	415
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	KRTAP10-7; APPBP2; COL4A3BP; UBC; PPP1R14A; DBNDD2; APP; RUNDC3B; C2orf44; RAP1GAP; MTA1; PER1; NCK1; SMAD3;
Description of target	CSNK1G2 belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family, casein kinase I subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. It participates in Wnt signaling.
Nucleotide accession_num	NM_001319
Protein accession_num	NP_001310
Protein name	Casein kinase I isoform gamma-2
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human CSNK1G2
Homology	Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 85%; Rat: 93%; Zebrafish: 93%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer