« Back
Home /
MAP3K8 Antibody - N-terminal region

MAP3K8 Antibody - N-terminal region

Item no.	ARP30650_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Antibodies By Cell Type Melanoma Western Blot Primary Antibodies By Organ Bladder Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	ASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDL
Citations	Wittwer,T. (2008) Biochem. Biophys. Res. Commun. 371 (2), 294-297
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	COT,EST,ESTF,TPL2,AURA2,MEKK8,Tpl-2,c-COT
Similar products	MAP3K8
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/MAPK Signaling, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	53kDa
Species Tested	Human
Gene symbol	MAP3K8
Gene Fullname	Mitogen-activated protein kinase kinase kinase 8
Protein size	467
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	RELA; MAP2K1; RIPK1; NFKB1; ACY3; STIP1; HSP90AA1; TAB2; TRAF6; TRAF2; CD40; TNIP2; Nedd4; MAP3K14; MAP2K4; BMPR2; CHUK; REL; AKT1; NFKB2; KSR2;
Description of target	MAP3K8 is a member of the serine/threonine protein kinase family. This kinase can activate both the MAP kinase and JNK kinase pathways. This kinase was shown to activate IkappaB kinases, and thus induce the nuclear production of NF-kappaB. This kinase was
Nucleotide accession_num	NM_005204
Protein accession_num	NP_005195
Protein name	Mitogen-activated protein kinase kinase kinase 8
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human MAP3K8
Homology	Cow: 75%; Horse: 87%; Human: 100%; Mouse: 85%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 11/13/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer