Comparison

CARD9 Antibody - middle region

Item no. ARP57704_P050
Manufacturer AVIVA Systems Biology
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Dog (Canine, Canis lupus familiaris), Horse (Equine)
Host Rabbit
Sequence ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CANDF2,hCARD9
Similar products CARD9
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Microbiology, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
62kDa
Species Tested
Human
Gene symbol
CARD9
Gene Fullname
Caspase recruitment domain family, member 9
Protein size
536
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
KRTAP10-3; MFAP1; MEOX2; LMO1; ABLIM1; KRT31; KRT19; PHC2; DAXX; TRIM23; AES; KRTAP10-5; KRTAP10-1; CCDC36; TRIM42; CEP57L1; RTP5; PPP1R18; TCEANC; ALS2CR11; ZNF417; CWF19L2; ZNF572; KRT40; SSX2IP; PNMA5; C1orf94; ZNF587; LZTS2; ZCCHC7; FAM161A; CEP70; FA
Description of target
The protein encoded by this gene is a member of the CARD protein family, which is defined by the presence of a characteristic caspase-associated recruitment domain (CARD). CARD is a protein interaction domain known to participate in activation or suppression of CARD containing members of the caspase family, and thus plays an important regulatory role in cell apoptosis. This protein was identified by its selective association with the CARD domain of BCL10, a postive regulator of apoptosis and NF-kappaB activation, and is thought to function as a molecular scaffold for the assembly of a BCL10 signaling complex that activates NF-kappaB. Several alternatively spliced transcript variants have been observed, but their full-length nature is not clearly defined.
Nucleotide accession_num
NM_052813
Protein accession_num
NP_434700
Protein name
Caspase recruitment domain-containing protein 9
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CARD9
Homology
Dog: 92%; Horse: 86%; Human: 100%; Mouse: 90%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close