« Back
Home /
STAT4 Antibody - N-terminal region

STAT4 Antibody - N-terminal region

Item no.	ARP33376_T100
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Metabolism Diabetes Neural Transcription Factors Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Antibodies By Cell Type Immunohistochemistry Western Blot Primary Antibodies By Organ Bladder Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus)
Host	Rabbit
Sequence	IGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQ
Citations	Torpey,N., et al., (2004) J. Biol. Chem. 279 (25), 26789-26796
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SLEB11
Similar products	STAT4
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	86 kDa
Species Tested	Human, Mouse
Gene symbol	STAT4
Gene Fullname	Signal transducer and activator of transcription 4
Protein size	748
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; ADRB2; TRIM28; FHL1; ZNF467; PIAS2; NMI; IL12RB2; IL12RB1; MAP2K6; STAT4; MAPK14; CREBBP; JUN; STAT3; IFNGR1;
Description of target	STAT4 is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is essential for mediating responses to IL12 in lymphocytes, and regulating the differentiation of T helper cells.
Nucleotide accession_num	NM_003151
Protein accession_num	NP_003142
Protein name	Signal transducer and activator of transcription 4
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human STAT4
Homology	Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 92%
Concentration	1.0 mg/ml
Sample Type Confirmation	STAT4 is supported by BioGPS gene expression data to be expressed in Jurkat

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer