« Back
Home /
PCYOX1 Antibody - C-terminal region

PCYOX1 Antibody - C-terminal region

Item no.	ARP33007_T100
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Neuroscience Neural Lineage Markers Neuroinflammation Metabolism Diabetes Glucose Homeostasis Aging & Neurological Disorders Antibodies Immunohistochemistry Western Blot Primary Antibodies Neurodegeneration Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Yeast (Saccharomyces cerevisiae), Cow (Bos taurus)
Host	Rabbit
Sequence	IFSQETLTKAQILKLFLSYDYAVKKPWLAYPHYKPPEKCPSIILHDRLYY
Citations	Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PCL1
Similar products	PCYOX1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Research Areas/Membrane & Traffic, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	57kDa
Species Tested	Human
Gene symbol	PCYOX1
Gene Fullname	Prenylcysteine oxidase 1
Protein size	505
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; SLC9A3R1; NDUFV2;
Description of target	Prenylated proteins contain one of two isoprenoid lipids, either the 15-carbon farnesyl or the 20-carbon geranylgeranyl, covalently attached to cysteine residues at or near their C terminus. PCYOX1 is capable of cleaving the thioether bond of prenylcysteines. The enzyme was isolated from bovine brain membranes and exhibits an apparent molecular mass of 63 kDa. This is a specific enzyme involved in prenylcysteine metabolism in mammalian cells, most likely comprising the final step in the degradation of prenylated proteins.
Nucleotide accession_num	NM_016297
Protein accession_num	NP_057381
Protein name	Prenylcysteine oxidase 1
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human PCYOX1
Homology	Cow: 83%; Dog: 86%; Horse: 86%; Human: 100%; Pig: 83%; Rabbit: 100%; Yeast: 75%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 1/29/2026

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer