« Back
Home /
CNP Antibody - N-terminal region

CNP Antibody - N-terminal region

Item no.	ARP33880_T100
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies Immunoprecipitation Western Blot Primary Antibodies By Organ Testicular & Prostate Cancer Calcium Binding Protein Markers Microglia Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IP
Specific against	Human (Homo sapiens), Rat (Rattus norvegicus), Sheep (Ovine, Ovis aries), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF
Citations	Peirce,T.R., et al., (2006) Arch. Gen. Psychiatry 63 (1), 18-24
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CNP1,HLD20
Similar products	CNP
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Membrane & Traffic, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	45kDa
Species Tested	Human, Mouse
Gene symbol	CNP
Gene Fullname	2', 3'-cyclic nucleotide 3' phosphodiesterase
Protein size	401
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; FAM96B; CIAO1; SOX2; MMS19; PEX14; MTNR1A; PRNP; PPP1CA; TUBA1A; PRKCD;
Description of target	2', 3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm
Nucleotide accession_num	NM_033133
Protein accession_num	NP_149124
Protein name	2', 3'-cyclic-nucleotide 3'-phosphodiesterase
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human CNP
Homology	Cow: 85%; Dog: 92%; Horse: 100%; Human: 100%; Pig: 92%; Rat: 77%; Sheep: 100%
Concentration	1.0 mg/ml
Sample Type Confirmation	CNP is supported by BioGPS gene expression data to be expressed in Jurkat

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 2/26/2026

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer