« Back
Home /
MST1 Antibody - middle region

MST1 Antibody - middle region

Item no.	ARP45724_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Food Safety Proteins Antibodies By Cell Type Immunohistochemistry Western Blot Primary Antibodies By Organ Lung Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE
Citations	Fisher,S.A., (er) Nat. Genet. (2008) In press
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	MSP,HGFL,NF15S2,D3F15S2,DNF15S2
Similar products	MST1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	80kDa
Species Tested	Human
Gene symbol	MST1
Gene Fullname	Macrophage stimulating 1 (hepatocyte growth factor-like)
Protein size	711
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	FOXO1; HIST2H2BE; MST1; DAXX; MOB1A; MST1R; KLKB1; SERPINA3;
Description of target	MST1 belongs to the peptidase S1 family, plasminogen subfamily. It contains 4 kringle domains, 1 PAN domain and 1 peptidase S1 domain. MST1 probably has no proteolytic activity, since crucial characteristic of serine proteases catalytic sites are not conserved.
Nucleotide accession_num	NM_020998
Protein accession_num	NP_066278
Protein name	Hepatocyte growth factor-like protein
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human MST1
Homology	Cow: 77%; Dog: 85%; Horse: 85%; Human: 100%; Pig: 86%; Rabbit: 86%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 11/27/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer