« Back
Home /
BTNL9 Antibody - N-terminal region

BTNL9 Antibody - N-terminal region

Item no.	ARP53034_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Metabolism Cholesterol & Lipid Metabolism Antibodies Western Blot Primary Antibodies Butyrophilins
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Horse (Equine)
Host	Rabbit
Sequence	EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL
Citations	Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	BTN3,BTN8,VDLS1900
Similar products	BTNL9
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	60kDa
Species Tested	Human
Gene symbol	BTNL9
Gene Fullname	Butyrophilin-like 9
Protein size	535
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	The specific function of BTNL9 is not yet known.
Nucleotide accession_num	NM_152547
Protein accession_num	NP_689760
Protein name	Butyrophilin-like protein 9
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human BTNL9
Homology	Horse: 79%; Human: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 1/8/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer