Comparison

TIMELESS Antibody - N-terminal region

Item no. ARP34186_P050
Manufacturer AVIVA Systems Biology
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB, IHC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Sheep (Ovine, Ovis aries), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host Rabbit
Sequence IGERDLIFHKGLHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVR
Citations Maruyama,K. (2005) Mol. Cell. Biol. 25 (8), 3109-3116
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias TIM,TIM1,hTIM
Similar products TIMELESS
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/DNA Damage & Repair, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
139 kDa
Species Tested
Human
Gene symbol
TIMELESS
Gene Fullname
Timeless homolog (Drosophila)
Protein size
1208
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
UBC; TUT1; TF; XRCC1; FKBP3; SP1; SUMO2; Tipin; Timeless; ZSCAN1; PCBD1; CRY1; PER2; PER1; CLSPN; PCNA; per; Clock; ATRIP; CRY2; CHEK1;
Description of target
The human Timeless protein interacts with both the circadian clock protein cryptochrome 2 and with the cell cycle checkpoint proteins Chk1 and the ATR-ATRIP complex and plays an important role in the DNA damage checkpoint response. Down-regulation of Timeless in human cells seriously compromises replication and intra-S checkpoints, indicating an intimate connection between the circadian cycle and the DNA damage checkpoints that is in part mediated by the Timeless protein.
Nucleotide accession_num
NM_003920
Protein accession_num
NP_003911
Protein name
Protein timeless homolog
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TIMELESS
Homology
Cow: 92%; Dog: 85%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Mouse: 85%; Pig: 85%; Rabbit: 77%; Rat: 85%; Sheep: 77%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Delivery expected until 2/12/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close