« Back
Home /
ANGPTL3 Antibody - N-terminal region

ANGPTL3 Antibody - N-terminal region

Item no.	ARP42412_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Neuroscience Neural Lineage Markers Targets for Rodent Neurosciences Antibodies Immunohistochemistry Western Blot Primary Antibodies By Organ Colorectal Cancer Neurodegeneration Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Goat (Caprine, Capra aegagrus hircus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL
Citations	Kathiresan,S., (2008) Nat. Genet. 40 (2), 189-197
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ANL3,ANG-5,FHBL2,ANGPT5
Similar products	ANGPTL3
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Products/Polyclonal Antibodies/Cell Adhesion, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	54 kDa
Species Tested	Human
Gene symbol	ANGPTL3
Gene Fullname	Angiopoietin-like 3
Protein size	460
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; ITGAV; ITGB3; ITGA5;
Description of target	The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. It is predominantly expressed in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil dom
Nucleotide accession_num	NM_014495
Protein accession_num	NP_055310
Protein name	Angiopoietin-related protein 3
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPTL3
Homology	Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 86%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 1/29/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer