Comparison

IRF8 antibody - middle region (P100842_P050)

Item no. P100842_P050
Manufacturer AVIVA Systems Biology
Amount 50 ug
Category
Type Antibody Polyclonal
Applications WB, IHC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cattle (Bovine)
Host Rabbit
Sequence QLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDIC ASHQRSFFRENQQIT
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias H-ICSBP,ICSBP,ICSBP1,IRF-8
Similar products IRF8
Available
Molecular Weight
48kDa
Description
This is a rabbit polyclonal antibody against IRF8. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (mailto:infohoelzel.de'>infohoelzel.de).
Gene symbol
IRF8
Protein size
426
Reconstitution and storage
Add 50 ul of distilled water. Final anti-IRF8 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Partner proteins
TRIM24, TRIM28, TRIM24, TRIM28
Description of target
Interferon regulatory factor 8 (IRF8, interferon consensus sequence-binding protein, ICSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-. and IFN-.. IRF family proteins also control expression of IFN-. and IFN-.-regulated genes that are induced by viral infection. Interferon consensus sequence-binding protein (ICSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Purification
Affinity Purified
Immunogen
The immunogen for anti-IRF8 antibody: synthetic peptide directed towards the middle region of human IRF8
Homology
Human, Bovine, Dog, Guinea pig, Horse, Mouse, Rabbit, Rat, African clawed frog, Pig, Chicken

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close