Comparison

TRIM41 Antibody - C-terminal region

Item no. ARP40084_P050
Manufacturer AVIVA Systems Biology
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Cow (Bos taurus)
Host Rabbit
Sequence RGVRLAERRQEVADHPKRFSADCCVLGAQGFRSGRHYWEEPKEPSWPPAQ
Citations Chen,D., (2007) J. Biol. Chem. 282 (46), 33776-33787
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias RINCK
Similar products TRIM41
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
72kDa
Species Tested
Human
Gene symbol
TRIM41
Gene Fullname
Tripartite motif containing 41
Protein size
630
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
ZNF264; TOP3B; NCK2; ZSCAN26; ZNF138; ZSCAN21; ZNF26; MEOX2; KIFC3; EHHADH; PHC2; CSNK2A2; CHD2; AES; MORF4L1; RNPS1; ZNF266; SORBS3; ZBTB24; KRTAP10-9; ZBTB38; FAM124A; ZNF564; ZNF417; FRA10AC1; ZNF670; TRIM41; ZNF587; PUS7L; CEP44; ZFP2; ZNF329; AEN; ZN
Description of target
The TRIM41 gene encodes a protein observed in the cytoplasm and the nucleus. Nuclear transport is mediated by an N-terminal segment common to both alpha and beta isoforms, but independent of a classical nuclear localization signal sequence. TRIM41 belongs to a family of tripartite motif (TRIM) proteins defined as containing a RING finger, one or more B-box domains, and a coiled-coil region (Tanaka et al., 2005 [PubMed 16022281]). See TRIM45 (MIM 609318).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-84 BM457526.1 1-84 85-439 BX396615.2 116-470 440-2161 AK027601.1 456-2177 2162-3618 AF258579.1 561-2017 3619-3639 BC018765.1 2693-2713 3640-3641 AL832960.1 2760-2761
Nucleotide accession_num
NM_033549
Protein accession_num
NP_291027
Protein name
E3 ubiquitin-protein ligase TRIM41
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM41
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close