« Back
Home /
CREG2 Antibody - N-terminal region

CREG2 Antibody - N-terminal region

Item no.	ARP53207_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Neuroscience Metabolism Diabetes Targets for Rodent Neurosciences Aging & Neurological Disorders Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH
Citations	Kunita,R., (2002) Genomics 80 (5), 456-460
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	CREG2
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	32kDa
Species Tested	Human
Gene symbol	CREG2
Gene Fullname	Cellular repressor of E1A-stimulated genes 2
Protein size	290
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	The exact functions of CREG2 remain unknown.
Nucleotide accession_num	NM_153836
Protein accession_num	NP_722578
Protein name	Protein CREG2
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human CREG2
Homology	Cow: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 11/13/2025

Express Delivery: Save 7 days

Compare

Add to wishlist

Get an offer