« Back
Home /
JARID2 Antibody - N-terminal region

JARID2 Antibody - N-terminal region

Item no.	ARP58842_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Neuroscience Neural Lineage Markers Targets for Rodent Neurosciences Antibodies Western Blot Primary Antibodies By Organ Bladder Cancer Neurodegeneration Markers Neuronal Cell Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Cow (Bos taurus)
Host	Rabbit
Sequence	THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ
Citations	Olsen,J.V., (2006) Cell 127 (3), 635-648
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	JMJ
Similar products	JARID2
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Neurobiology, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Methylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	139kDa
Species Tested	Human
Gene symbol	JARID2
Gene Fullname	Jumonji, AT rich interactive domain 2
Protein size	1246
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	SUZ12; EZH2; GATA4; NKX2-5; ALB; ELAVL1; SETDB1; MTF2; EHMT1; EHMT2; NPPA;
Description of target	This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a
Nucleotide accession_num	NM_017566
Protein accession_num	NP_004964
Protein name	Protein Jumonji
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human JARID2
Homology	Cow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 100%
Concentration	0.5 mg/ml
Sample Type Confirmation	JARID2 is strongly supported by BioGPS gene expression data to be expressed in 721_B JARID2 is supported by BioGPS gene expression data to be expressed in HeLa

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 1/29/2026

Compare

Add to wishlist

Get an offer

Request delivery time