Comparison

CTNNB1 Antibody - N-terminal region

Item no. P100600_T100
Manufacturer AVIVA Systems Biology
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio)
Host Rabbit
Sequence SLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRV
Citations Strausberg, R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903.
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias EVR7,CTNNB,MRD19,NEDSDV,armadillo
Similar products CTNNB1
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Cell Adhesion, Root Catalog/Products/Polyclonal Antibodies/Growth Factors & Hormones, Root Catalog/Products/Monoclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Cardiovascular, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal, Root Catalog/Research Areas/Cancer/Cancer Cell Adhesion, Root Catalog/Research Areas/Cancer/Cancer Transcription Factor
Shipping Temperature
Wet Ice
Molecular Weight
85kDa
Species Tested
Human
Gene symbol
CTNNB1
Gene Fullname
Catenin (cadherin-associated protein), beta 1, 88kDa
Protein size
781
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
PPARD; PLA2G4A; FBXO45; BTRC; SUMO1; UBC; HUWE1; CDH5; CDH2; TCF4; TBL1X; SOX1; SKP1; RNF220; CACYBP; FBXW11; SUMO2; SIAH1; Apc2; COPS5; RNF14; CDH1; SP1; KCTD1; MDM2; UBE2B; GSK3B; NEK2; RBX1; PTGS2; STRN3; LATS2; APC; ELAVL1; AMOT; ABL1; AXIN1; CBL; LEF
Description of target
CTNNB1 is involved in the regulation of cell adhesion and in signal transduction through the Wnt pathway.
Nucleotide accession_num
NM_001904
Protein accession_num
NP_001895
Protein name
Catenin beta-1
Clonality
Polyclonal
Purification
Protein A purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CTNNB1
Homology
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 83%
Concentration
1.0 mg/ml
Sample Type Confirmation

CTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close