« Back
Home /
ADRB1 Antibody - middle region

ADRB1 Antibody - middle region

Item no.	ARP36551_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Development Antibodies By Cell Type Hematology Leukemia Melanoma Western Blot Cardiovascular Research Heart Failure Myocardial Infarction Primary Antibodies Arrhythmias
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Pig (Porcine, Sus scrofa domesticus)
Host	Rabbit
Sequence	CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
Citations	Propranolol sensitizes thyroid cancer cells to cytotoxic effect of vemurafenib. Oncol. Rep. 36, 1576-84 (2016). 27432558 Tsai, W.-C. et al. Testosterone replacement increases aged pulmonary vein and left atrium arrhythmogenesis with enhanced adrenergic activity. Int. J. Cardiol. 176, 110-8 (2014). 25037694 Ulucan,C., (er) J. Cardiovasc. Electrophysiol. (2008) In press
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	RHR,B1AR,FNSS2,ADRB1R,BETA1AR
Similar products	ADRB1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling, Root Catalog/Products/Polyclonal Antibodies/Growth Factors & Hormones, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Research Areas/Cardiovascular, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Receptors, Root Catalog/Research Areas/GPCR, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	51 kDa
Species Tested	Human
Gene symbol	ADRB1
Gene Fullname	Adrenergic, beta-1-, receptor
Protein size	477
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	GPRASP1; GPRASP2; SNTA1; ARRB2; ARRB1; MAGI2; DLG4; GRB2; ADRA2A; MAGI3; DLGAP2; GOPC; GIPC1; SH3GL2; SH3GL3; DLG1; NOS1;
Description of target	The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Nucleotide accession_num	NM_000684
Protein accession_num	NP_000675
Protein name	Beta-1 adrenergic receptor
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human ADRB1
Homology	Dog: 87%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer