« Back
Home /
PLPP1 Antibody - N-terminal region

PLPP1 Antibody - N-terminal region

Item no.	ARP42721_T100
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Antibodies Immunohistochemistry Western Blot Cardiovascular Research Hypertension Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig
Host	Rabbit
Sequence	QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV
Citations	Evseenko, D. et al. Lysophosphatidic acid mediates myeloid differentiation within the human bone marrow microenvironment. PLoS One 8, e63718 (2013). 23696850 Tanyi,J.L., Clin. Cancer Res. 9 (10 PT 1), 3534-3545 (2003)
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	LPP1,PAP2,LLP1a,PAP-2a,PPAP2A
Similar products	PPAP2A
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Research Areas/Membrane & Traffic, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/GPCR, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	31kDa
Species Tested	Human
Gene symbol	PLPP1
Gene Fullname	phospholipid phosphatase 1
Protein size	285
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	FAHD1; IGF2BP2; ILF3; UBC; FXYD1;
Description of target	The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme is an integral membrane glycoprotein that plays a role in the hydrolysis and uptake of lipids from extracellular space. Alternate splicing results in multiple transcript variants of this gene.
Nucleotide accession_num	NM_176895
Protein accession_num	NP_795714
Protein name	phospholipid phosphatase 1
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human PPAP2A
Homology	Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rat: 93%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer