« Back
Home /
ERF Antibody - middle region

ERF Antibody - middle region

Item no.	ARP32257_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Neuroscience Neural Lineage Markers Targets for Rodent Neurosciences Aging & Neurological Disorders Antibodies Western Blot Primary Antibodies By Organ Colorectal Cancer Breast Cancer Neurodegeneration Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	SSSPFKFKLQRPPLGRRQRAAGEKAVAAADKSGGSAGGLAEGAGALAPPP
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PE2,CRS4,PE-2,CHYTS
Similar products	ERF
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	59kDa
Species Tested	Human
Gene symbol	ERF
Gene Fullname	Ets2 repressor factor
Protein size	548
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; PAXIP1; SUMO2; XPO1; EPHB2; CSNK1A1; MAPK1; HMGB1;
Description of target	Members of the ETS family of transcription factors, suchÂ¡Â¡as ERF, regulate cell proliferation and differentiation. They shareÂ¡Â¡a highly conserved DNA-binding domain, the ETS domain, thatÂ¡Â¡recognizes the sequence GGAA/T.
Nucleotide accession_num	NM_006494
Protein accession_num	AAA86686
Protein name	ETS domain-containing transcription factor ERF
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human ERF
Homology	Human: 92%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 1/29/2026

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer