« Back
Home /
ZNF175 Antibody - N-terminal region

ZNF175 Antibody - N-terminal region

Item no.	ARP35832_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	MPADVNLSQKPQVLGPEKQDGSCEASVSFEDVTVDFSREEWQQLDPAQRC
Citations	Carlson,K.A., et al., (2004) J. Neuroimmunol. 150 (1-2), 186-198
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	OTK18
Similar products	ZNF175
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	82kDa
Species Tested	Human
Gene symbol	ZNF175
Gene Fullname	Zinc finger protein 175
Protein size	711
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	KRTAP10-7; ZNF250; ZNF264; PSTPIP1; ALAS1; LPXN; UBC; LZTR1; CDC42;
Description of target	ZNF175 expression in brain mononuclear phagocytes is a signature for advanced HIV-1 encephalitis. As a transcriptional suppressor, this protein plays a role in macrophage control of viral replication during advanced HIV-1 infection.
Nucleotide accession_num	NM_007147
Protein accession_num	NP_009078
Protein name	Zinc finger protein 175
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF175
Homology	Human: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 7 days

Compare

Add to wishlist

Get an offer