« Back
Home /
SERPINB4 Antibody - N-terminal region

SERPINB4 Antibody - N-terminal region

Item no.	ARP42085_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Food Safety Allergenes Antibodies By Cell Type Melanoma Western Blot Primary Antibodies By Organ Lung Cancer Testicular & Prostate Cancer Pancreatic Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Rabbit (Oryctolagus cuniculus)
Host	Rabbit
Sequence	TSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDRSGNVHHQ
Citations	Harden, C. J. et al. Evaluation of the salivary proteome as a surrogate tissue for systems biology approaches to understanding appetite. J. Proteomics 75, 2916-23 (2012). 22200674 Switching off IMMP2L signaling drives senescence via simultaneous metabolic alteration and blockage of cell death. Cell Res. 28, 625-643 (2018). 29808012
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PI11,SCCA1,SCCA2,LEUPIN,SCCA-2
Similar products	SERPINB4
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Mitochondria, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Research Areas/Tissue Specific & Cell Marker, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	45
Species Tested	Human
Gene symbol	SERPINB4
Gene Fullname	Serpin peptidase inhibitor, clade B (ovalbumin), member 4
Protein size	390
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	CTSG; MAPK8; SIRT1; ESR1; COPS5; CUL2; CUL5; BTRC; CTSS; USF2;
Description of target	SERPINB4 may act as a protease inhibitor to modulate the host immune response against tumor cells.
Nucleotide accession_num	NM_002974
Protein accession_num	NP_002965
Protein name	Serpin B4
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINB4
Homology	Human: 100%; Rabbit: 90%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer