« Back
Home /
MRPS2 Antibody - N-terminal region

MRPS2 Antibody - N-terminal region

Item no.	ARP56812_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Infectious Diseases Viral Infections Coronavirus (COVID-19) Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR
Citations	Kimura,K., (2006) Genome Res. 16 (1), 55-65
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	S2mt,CGI-91,MRP-S2,COXPD36
Similar products	MRPS2
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	33kDa
Species Tested	Human
Gene symbol	MRPS2
Gene Fullname	Mitochondrial ribosomal protein S2
Protein size	296
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	CEP250; TUBGCP3; TP53; SUMO2; GRSF1; UBC; SUMO1; NEDD8; ESR2; C1QBP; MRPS16; MRPS9; SSBP1; OGDH; APP; ACTA2; CAND1; CUL5; ICT1;
Description of target	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
Nucleotide accession_num	NM_016023
Protein accession_num	NP_057118
Protein name	28S ribosomal protein S2, mitochondrial
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human MRPS2
Homology	Human: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer