« Back
Home /
PLSCR1 Antibody - N-terminal region

PLSCR1 Antibody - N-terminal region

Item no.	ARP57514_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Neuroscience Neural Lineage Markers Metabolism Glucose Homeostasis Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Signaling Protein Aggregation, Clearance & Misfolding Antibodies Immunohistochemistry Western Blot Primary Antibodies By Organ Heart & Blood Cancer Calcium Binding Protein Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris)
Host	Rabbit
Sequence	MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	MMTRA1B
Similar products	PLSCR1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	35kDa
Species Tested	Human
Gene symbol	PLSCR1
Gene Fullname	Phospholipid scramblase 1
Protein size	318
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	PKD2; P2RY6; ILF3; EWSR1; ESR2; DOCK2; CTSZ; CATSPER1; LONRF1; KRTAP4-2; ZNF587; LINC01547; KRTAP9-2; GDPD5; SCNM1; DMRT3; VPS37C; PRR13; DEF6; LGALS9C; KRTAP4-11; KRTAP5-6; KRTAP10-3; KRTAP10-11; KRTAP10-9; LCE3C; LCE2D; TRIM42; BCL6B; LCE4A; ZNF417; MGA
Description of target	PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
Nucleotide accession_num	NM_021105
Protein accession_num	NP_066928
Protein name	Phospholipid scramblase 1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human PLSCR1
Homology	Dog: 85%; Human: 100%; Rabbit: 77%
Concentration	0.5 mg/ml
Sample Type Confirmation	PLSCR1 is supported by BioGPS gene expression data to be expressed in HT1080

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 2/26/2026

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer