« Back
Home /
C1orf142 Antibody - middle region

C1orf142 Antibody - middle region

Item no.	ARP58429_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Antibodies Western Blot Cardiovascular Research Heart Failure Hypertension Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Rabbit (Oryctolagus cuniculus), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA
Citations	Deloukas,P., (2004) Nature 429 (6990), 375-381
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SVAP1,HEL170,SNAP-47,C1orf142,ESFI5812,HEL-S-290
Similar products	C1orf142
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	51kDa
Species Tested	Human
Gene symbol	SNAP47
Gene Fullname	Synaptosomal-associated protein, 47kDa
Protein size	464
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	CEP57L1; FAM9B; KLC3; FATE1; MID2; SPAG5; STX4; MAGEA6; GOLGA2; UBC; UBD;
Description of target	The function of this protein remains unknown.
Nucleotide accession_num	NM_138812
Protein accession_num	NP_444280
Protein name	Synaptosomal-associated protein 47
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human C1orf142
Homology	Cow: 86%; Horse: 86%; Human: 100%; Pig: 92%; Rabbit: 86%; Zebrafish: 92%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer