« Back
Home /
LGALS9 Antibody - middle region

LGALS9 Antibody - middle region

Item no.	ARP72264_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Antibodies Cell Biology Cell Movement Cell Adhesion Western Blot Primary Antibodies By Organ Lymphatic System Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Goat (Caprine, Capra aegagrus hircus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFV
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	HUAT,LGALS9A
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	35kDa
Species Tested	Human
Gene symbol	LGALS9
Gene Fullname	galectin 9
Protein size	323
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	SLC1A5; JUP; CTNNB1;
Description of target	The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin' s disease tissue and might participate in the interaction between the H& RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene.
Protein name	galectin-9
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of Human LGALS9
Homology	Cow: 79%; Dog: 79%; Goat: 100%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 86%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 1/29/2026

Express Delivery: Save 10 days

Compare

Add to wishlist

Get an offer