« Back
Home /
IFNA5 Antibody - middle region

IFNA5 Antibody - middle region

Item no.	ARP54652_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Neuroscience Neural Lineage Markers Neural Transcription Factors Targets for Rodent Neurosciences Neural Epigenetics Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Horse (Equine)
Host	Rabbit
Sequence	TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY
Citations	Janssen,R., (2007) J. Infect. Dis. 196 (6), 826-834
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	INA5,INFA5,leIF G,IFN-alphaG,IFN-alpha-5
Similar products	IFNA5
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Research Areas/JAK-STAT, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	20kDa
Species Tested	Human
Gene symbol	IFNA5
Gene Fullname	Interferon, alpha 5
Protein size	189
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	APP; IFNAR2;
Description of target	Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.
Nucleotide accession_num	NM_002169
Protein accession_num	NP_002160
Protein name	Interferon alpha-5
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human IFNA5
Homology	Guinea Pig: 85%; Horse: 77%; Human: 100%; Mouse: 77%; Rat: 77%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer