« Back
Home /
KIAA0652 Antibody - C-terminal region (OABB01963)

KIAA0652 Antibody - C-terminal region (OABB01963)

Item no.	OABB01963
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Antibodies Cell Biology Cell Status Western Blot Autophagy Primary Antibodies
Type	Antibody Polyclonal
Applications	WB
Specific against	other
Host	Rabbit
Isotype	IgG
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Gene symbol	KIAA0652
Product format	Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Gene id	9776
Reconstitution and storage	Add 0.2 ml of distilled water will yield a concentration of 500 ug/ml. +4C
Description of target	Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation. It is located on 11p11.2. And ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through phosphorylation of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.
Purification	Immunogen affinity purified.
Clonality	Polyclonal
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human KIAA0652 (488-517aa MAEDLDSLPEKLAVHEKNVREFDAFVETLQ), identical to the related mouse sequence.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OABB01963-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/9/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer