« Back
Home /
ATG14L Antibody - N-terminal region (OABB01964)

ATG14L Antibody - N-terminal region (OABB01964)

Item no.	OABB01964
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Antibodies Cell Biology Cell Status Immunohistochemistry Western Blot Autophagy Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IHC-P
Specific against	other
Host	Rabbit
Isotype	IgG
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Gene symbol	ATG14L
Product format	Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Gene id	22863
Reconstitution and storage	Add 0.2 ml of distilled water will yield a concentration of 500 ug/ml. +4C
Description of target	ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes.
Purification	Immunogen affinity purified.
Clonality	Polyclonal
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OABB01964-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/9/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer