« Back
Home /
CEND1 Antibody - N-terminal region

CEND1 Antibody - N-terminal region

Item no.	ARP47273_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Antibodies Western Blot Primary Antibodies By Organ Nervous System Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine)
Host	Rabbit
Sequence	MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ
Citations	Lim,J., (2006) Cell 125 (4), 801-814
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	BM88
Similar products	CEND1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Research Areas/Stem Cells, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	15kDa
Species Tested	Human
Gene symbol	CEND1
Gene Fullname	Cell cycle exit and neuronal differentiation 1
Protein size	149
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	GLP1R; UBQLN4; EGFR;
Description of target	CEND1 is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. The protein encoded by this gene is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported for this gene.
Nucleotide accession_num	NM_016564
Protein accession_num	NP_057648
Protein name	Cell cycle exit and neuronal differentiation protein 1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human CEND1
Homology	Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 2/26/2026

Express Delivery: Save 9 days

Compare

Add to wishlist

Get an offer