« Back
Home /
Recombinant rat Urokinase plasminogen activator surface receptor

Recombinant rat Urokinase plasminogen activator surface receptor

Item no.	OPCA00185
Manufacturer	AVIVA Systems Biology
Amount	10 ug
Category	Oncology Food Safety Proteins Peptides & Proteins Recombinant Proteins Cardiovascular Research Atherosclerosis By Organ Breast Cancer
Type	Proteins Recombinant
Format	Liquid
Specific against	Rat (Rattus norvegicus)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQ
Citations	The receptor for the plasminogen activator of urokinase type is up-regulated in transformed rat thyroid cells.Ragno P., Cassano S., Degen J., Kessler C., Blasi F., Rossi G.FEBS Lett. 306:193-198(1992)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Par;plasminogen activator urokinase receptor 3;Plaur3;uPAR;U-PAR;uPAR-2;uPAR-3;urinary plasminogen activator receptor 2;urinary plasminogen activator receptor 3;urokinase plasminogen activator receptor;urokinase plasminogen activator surface receptor.
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Molecular Weight	34.1 kDa
Gene symbol	Plaur
Gene Fullname	plasminogen activator, urokinase receptor
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA.
Protein name	Urokinase plasminogen activator surface receptor
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPCA00185-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 7 days

Compare

Add to wishlist

Get an offer