« Back
Home /
Recombinant human Regenerating islet-derived protein 3-alpha

Recombinant human Regenerating islet-derived protein 3-alpha

Item no.	OPCA00200
Manufacturer	AVIVA Systems Biology
Amount	10 ug
Category	Oncology Metabolism Diabetes By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Adenocarcinoma Mesothelioma Autophagy Cardiovascular Research Proliferation Myocardial Infarction By Organ Testicular & Prostate Cancer
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Citations	Molecular basis for peptidoglycan recognition by a bactericidal lectin.Lehotzky R.E., Partch C.L., Mukherjee S., Cash H.L., Goldman W.E., Gardner K.H., Hooper L.V.Proc. Natl. Acad. Sci. U.S.A. 107:7722-7727(2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	hepatocarcinoma-intestine-pancreas;hepatointestinal pancreatic protein;HIP;HIP/PAP;human proislet peptide;INGAP;pancreatic beta cell growth factor;pancreatitis-associated protein 1;PAP;PAP homologous protein;PAP1;PAP-H;PBCGF;proliferation-inducing protein 34;proliferation-inducing protein 42;reg III-alpha;REG3;REG-3-alpha;regenerating islet-derived 3 alpha;regenerating islet-derived protein 3-alpha;regenerating islet-derived protein III-alpha;REG-III.
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Molecular Weight	43.6 kDa
Gene symbol	REG3A
Gene Fullname	regenerating family member 3 alpha
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
Protein name	Regenerating islet-derived protein 3-alpha
Purification	Affinity purified using AC

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPCA00200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer