« Back
Home /
CSH1 Recombinant Protein (Human)

CSH1 Recombinant Protein (Human)

Item no.	OPCA00912
Manufacturer	AVIVA Systems Biology
Amount	10 ug
Category	Oncology Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience By Cell Type Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Citations	The human growth hormone locus: nucleotide sequence, biology, and evolution.Chen E.Y., Liao Y.C., Smith D.H., Barrera-Saldana H.A., Gelinas R.E., Seeburg P.H.Genomics 4:479-497(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	choriomammotropin;chorionic somatomammotropin A;chorionic somatomammotropin hormone 1;Chorionic somatomammotropin hormone 2;chorionic somatomammotropin-1;CS-1;CSA;CSMT;GHB3;growth hormone B3;hCS-1;hCS-A;Lactogen;PL;placental lactogen.
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Molecular Weight	26.3 kDa
Gene symbol	CSH1
Gene Fullname	chorionic somatomammotropin hormone 1
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.
Protein name	Chorionic somatomammotropin hormone 1
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPCA00912-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 11/13/2025

Express Delivery: Save 7 days

Compare

Add to wishlist

Get an offer