« Back
Home /
Recombinant human Type-1 angiotensin II receptor

Recombinant human Type-1 angiotensin II receptor

Item no.	OPCA01197
Manufacturer	AVIVA Systems Biology
Amount	10 ug
Category	Peptides & Proteins Recombinant Proteins Cardiovascular Research Heart Failure Myocardial Infarction Hypertension
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE
Citations	Cloning, expression, and characterization of a gene encoding the human angiotensin II type 1A receptor.Mauzy C.A., Hwang O., Egloff A.M., Wu L.H., Chung F.-Z.Biochem. Biophys. Res. Commun. 186:277-284(1992)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	AG2S;AGTR1B;Angiotensin II type-1 receptor;AT1;AT1AR;AT1B;AT1BR;AT1R;AT2R1;HAT1R;type-1 angiotensin II receptor;type-1B angiotensin II receptor.
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Molecular Weight	9.2 kDa
Gene symbol	AGTR1
Gene Fullname	angiotensin II receptor type 1
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Protein name	Type-1 angiotensin II receptor
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPCA01197-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer