« Back
Home /
NRG1 Protein

NRG1 Protein

Item no.	OPPA00668
Manufacturer	AVIVA Systems Biology
Amount	10 ug
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Signaling By Cell Type Carcinoma Melanoma Peptides & Proteins Recombinant Proteins Adenocarcinoma Neuronal Cell Markers
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 96.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Sequence	SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GGF,HGL,HRG,NDF,ARIA,GGF2,HRG1,HRGA,SMDF,MST131,MSTP131,NRG1-IT2
Similar products	NRG1
Shipping Condition	Room temperature
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Room Temperature
Gene symbol	NRG1
Protein size	Recombinant
Product format	Lyophilized from a 0.2um filtered solution (0.25mg/ml) in 20mM PB, pH 7.0, containing 0.5%HSA and 2% mannitol. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Reconstitution and storage	Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Heregulin should be stored at 4C between 2-7 days and for future use below -18C. Please prevent freeze-thaw cycles.
Description of target	Recombinant Human Neuregulin-1/Heregulin-b2
Protein accession_num	NP_001153467.1
Protein name	Pro-neuregulin-1, membrane-bound isoform

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPPA00668-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer