« Back
Home /
IL 13 Protein

IL 13 Protein

Item no.	OPPA00705
Manufacturer	AVIVA Systems Biology
Amount	2 ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Type	Proteins Recombinant
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 95% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Sequence	GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	P600,IL-13
Similar products	IL 13
Shipping Condition	Room temperature
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Room Temperature
Gene symbol	IL-13
Protein size	Recombinant
Product format	The protein (1mg/ml) was lyophilized with 1X PBS pH-7.2. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Reconstitution and storage	Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution IL13 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA). Please prevent freeze-thaw cycles.
Description of target	Recombinant Human Interleukin-13
Protein accession_num	NP_002179.2
Protein name	Interleukin-13

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPPA00705-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 2 ug

available

Delivery expected until 11/13/2025

Express Delivery: Save 10 days

Compare

Add to wishlist

Get an offer