Comparison

UBE2D3 Protein

Item no. OPPA00860
Manufacturer AVIVA Systems Biology
Amount 2 ug
Category
Type Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Host E.coli
Purity Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Sequence MHHHHHHAMALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias UBC4/5,UBCH5C,E2(17)KB3
Similar products UBE2D3
Shipping Condition Room temperature
Available
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Shipping Temperature
Room Temperature
Gene symbol
UBE2D3
Protein size
Recombinant
Product format
Lyophilized from a 0.2um filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5. Physical appearance: Sterile Filtered white lyophilized powder.
Reconstitution and storage
Lyophilized UBE2D3 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution UBE2D3 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA). Please prevent freeze-thaw cycles.
Description of target
Recombinant Human Ubiquitin Conjugating Enzyme E2D3
Protein accession_num
NP_003331.1
Protein name
Ubiquitin-conjugating enzyme E2 D3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 2 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close