« Back
Home /
UBE2L3 Protein His

UBE2L3 Protein His

Item no.	OPPA00861
Manufacturer	AVIVA Systems Biology
Amount	10 ug
Category	Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Autophagy
Type	Proteins Recombinant
Format	Liquid
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Sequence	MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	E2-F1,L-UBC,UBCH7,UbcM4
Similar products	UBE2L3 His
Shipping Condition	Room temperature
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Room Temperature
Gene symbol	UBE2L3 HIS
Protein size	Recombinant
Product format	Lyophilized from a 0.2um filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5. Physical appearance: Sterile Filtered white lyophilized powder.
Reconstitution and storage	Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution UBE2L3 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA). Please prevent freeze-thaw cycles.
Description of target	Recombinant Human Ubiquitin-Conjugating Enzyme E2L 3, His Tag
Protein accession_num	NP_003338.1
Protein name	Ubiquitin-conjugating enzyme E2 L3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPPA00861-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 11/13/2025

Express Delivery: Save 10 days

Compare

Add to wishlist

Get an offer