« Back
Home /
TXN1 E.Coli Protein

TXN1 E.Coli Protein

Item no.	OPPA01249
Manufacturer	AVIVA Systems Biology
Amount	20 ug
Category	Oncology By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Senescence
Type	Proteins Recombinant
Format	Lyophilized
Specific against	Escherichia coli (E.coli)
Host	E.coli
Purity	Greater than 90.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Sequence	HMSDKIIHL TDDSFDTDVLKADGAIL VDFW AEWCGPCKMIAPILDEI GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL DANLA.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	dasC,ECK3773,fipA,tsnC
Similar products	TXN1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Wet Ice
Gene symbol	TXN1
Protein size	Recombinant
Product format	Each mg of protein contains 20mM phosphate buffer pH 7.4. Physical appearance: Sterile Lyophilized Powder.
Reconstitution and storage	TRX although stable at 4C for 3 weeks, should be stored desiccated below -18C. Please prevent freeze thaw cycles.
Description of target	Recombinant E.Coli Thioredoxin
Protein accession_num	AP_004016.1
Protein name	Thioredoxin-1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPPA01249-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 11/13/2025

Express Delivery: Save 9 days

Compare

Add to wishlist

Get an offer