« Back
Home /
Noggin Protein

Noggin Protein

Item no.	OPPA01649
Manufacturer	AVIVA Systems Biology
Amount	5 ug
Category	Neuroscience Neural Lineage Markers Neural Signaling Peptides & Proteins Recombinant Proteins Microglia Markers Neuron Nuclear Markers
Type	Proteins Recombinant
Format	Liquid
Specific against	Mouse (Murine, Mus musculus)
Host	E.coli
Purity	Greater than 95.0% as determined by SDS-PAGE.
Sequence	MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Noggin,SYM1,SYNS1,NOG,Noggin Mouse,Noggin Mouse Recombinant
Similar products	mNoggin
Shipping Condition	Room temperature
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Shipping Temperature	Room Temperature
Gene symbol	MNOGGIN
Protein size	Recombinant
Product format	Lyophilized from a 0.2um filtered solution in 30% CH3CN, 0.1% TFA. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Reconstitution and storage	Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Mouse Noggin should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA). Please prevent freeze-thaw cycles.
Description of target	Recombinant Mouse Noggin
Protein accession_num	NP_032737.1
Protein name	Noggin

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPPA01649-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 5 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer