Comparison

MMP 9 Protein

Item no. OPPA02019
Manufacturer AVIVA Systems Biology
Amount 2 ug
Category
Type Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Host E.coli
Purity Greater than 95.0% as determined by SDS-PAGE.
Sequence 4.5kDa His Tag-DLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDAD<br/>IVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFP<br/>FIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSA<br/>CTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTV
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias GELB,CLG4B,MMP-9,MANDP2
Similar products MMP 9
Shipping Condition Cool pack
Available
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
4.5 kDa amino-terminal hexahistidine tag
Shipping Temperature
Wet Ice
Molecular Weight
42 kDa
Gene symbol
MMP 9
Protein size
Recombinant
Product format
Liquid. 20mM Tris-HCl (pH 8.0) and 50% glycerol.
Reconstitution and storage
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Description of target
Matrix metalloproteinases are a family of zinc and calcium-dependent endopeptidases that break down extracellular matrix proteins. The MMP9 is secreted as a 92kDa zymogen. Cleavage of ProMMP-9 results in the active enzyme, having a molecular weight of approximately 82kDa. MMP9 is composed of the following domains: a gelatin-binding domain consisting of three fibronectin type II units, a catalytic domain containing the zinc-binding site, a proline-rich type V collagen-homologous domain and a hemopexin-like domain. MMP9 is produced by the several cell types: monocytes, macrophages, neutrophils, keratinocytes, fibroblasts, osteoclasts and endothelial cells. MMP9 is involved in inflammatory responses, tissue remodeling, wound healing, tumor growth and metastasis. MMP9 may also play an important part in local proteolysis of the extracellular matrix and in leukocyte migration, as well as in bone osteoclastic resorption. MMP9 cleaves type IV and type V collagens into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. MMP9 can also degrade fibronectin but not laminin or Pz-peptide. MMP9 defects may be a cause of susceptibility to intervertebral disc disease (IDD), also known as lumbar disk herniation (LDH). MMP-9 Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 338 amino acids fragment (113-450) corresponding to the catalytic domain of the protein.
Protein accession_num
NP_004985.2
Protein name
Matrix metalloproteinase-9
Purification
The MMP-9 is purified by proprietary chromatographic techniques.
Concentration
0.575 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 2 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close