« Back
Home /
Recombinant Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25), partial

Recombinant Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25), partial

Manufacturer	Biomatik
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes By Cell Type Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis Cardiovascular Research Ischemia & Reperfusion Injury
Type	Proteins
Specific against	Human
Amount	1mg
Item no.	BM-RPC20412-1mg
Targets	TNF ;;TNFRSF25
eClass 6.1	34160400
eClass 9.0	42020190
Available
UniProt ID	Q93038
Gene Name	TNFRSF25
Alternative Names	Apo-3, Apoptosis-inducing receptor AIR, Apoptosis-mediating receptor DR3, Apoptosis-mediating receptor TRAMP, Death receptor 3, Lymphocyte-associated receptor of death, Short name:LARD
Source	E.coli
Expression Region	25-199aa
AA Sequence	QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKA PCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQA CDEQASQVALENCSAVADTRCGCKPGWFVECQVSQ CVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGT CLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
Sequence Info	Extracellular Domain
Tag	N-terminal 6xHis-tagged
Theoretical MW	23.38kDa
Purity	>= 90%
Storage Instructions	Aliquot and store at -20C. Minimize freezing and thawing.
Expiry Date	1 year
Shipping Condition	Blue ice
Restriction	For research use only. Not for diagnostic procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 6/27/2024