« Back
Home /
Recombinant Human Rhomboid-related protein 2 (RHBDL2), partial

Recombinant Human Rhomboid-related protein 2 (RHBDL2), partial

Manufacturer	Biomatik
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Human
Amount	100ug
Item no.	BM-RPC21932-100ug
Targets	RHOD
eClass 6.1	34160400
eClass 9.0	42020190
Available
Estimated Turnaround Time	6-11 business days
UniProt ID	Q9NX52
Gene Name	RHBDL2
Alternative Names	Rhomboid-like protein 2
Source	E.coli
Expression Region	12-132aa
AA Sequence	MNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVH RIVSKWMLPEKSRGTYLERANCFPPPVFIISISLA ELAVFIYYAVWKPQKQWITLDTGILESPFIYSPEK REEAWRFISYMLVHAG
Sequence Info	Partial Length
Tag	N-terminal 6x His Tag
Theoretical MW	18.2 kDa
Purity	> 90% by SDS-PAGE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 6/27/2024