« Back
Home /
Recombinant Human S-phase kinase-associated protein 1 (SKP1)

Recombinant Human S-phase kinase-associated protein 1 (SKP1)

Manufacturer	Biomatik
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Human
Amount	50ug
Item no.	BM-RPC22007-50ug
eClass 6.1	34160400
eClass 9.0	42020190
Available
Estimated Turnaround Time	3-5 weeks
UniProt ID	P63208
Gene Name	SKP1
Alternative Names	Cyclin-A/CDK2-associated protein p19; p19AOrgan of Corti protein 2; OCP-2Organ of Corti protein II; OCP-IIRNA polymerase II elongation factor-like protein; SIIITranscription elongation factor B polypeptide 1-likep19skp1
Source	E.coli
Expression Region	2-163aa
AA Sequence	PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGM DDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPP PEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILA ANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNI KNDFTEEEEAQVRKENQWCEEK
Sequence Info	Full Length
Tag	C-terminal GST Tag
Theoretical MW	45.5 kDa
Purity	> 90% by SDS-PAGE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 5/30/2024